Lineage for d3htoa_ (3hto A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778583Species Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [188994] (4 PDB entries)
  8. 1778585Domain d3htoa_: 3hto A: [177835]
    Other proteins in same PDB: d3htob_
    automated match to d1rd8a_
    complexed with nag

Details for d3htoa_

PDB Entry: 3hto (more details), 2.95 Å

PDB Description: the hemagglutinin structure of an avian h1n1 influenza a virus
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d3htoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3htoa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]}
dticigyhannstdtvdtvleknvtvthsvnllednhngklcklngiaplqlgkcnvagw
llgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssferfeifpka
sswpnhettkgvtaacsyfgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvh
hppttseqqtlyqntdayvsvgsskynrrftpeiaarpkvrgqagrmnyywtlldqgdti
tfeatgnliapwyafalnkgsdsgiitsdapvhncdtkcqtphgainstlpfqnvhpiti
gecpkyvkstklrmatglrnipsi

SCOPe Domain Coordinates for d3htoa_:

Click to download the PDB-style file with coordinates for d3htoa_.
(The format of our PDB-style files is described here.)

Timeline for d3htoa_: