SCOPe 2.07: Domain d3htba_: 3htb A:

Lineage for d3htba_ (3htb A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (572 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3htba_: 3htb A: [177828]
   automated match to d1l19a_
   complexed with bme, jz4, po4

Details for d3htba_

PDB Entry: 3htb, 1.81 Å

PDB Description: 2-propylphenol in complex with T4 lysozyme L99A/M102Q

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d3htba_:

Sequence; same for both SEQRES and ATOM records:

>d3htba_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpdrakrvittfrtgtwdaykn

Timeline for d3htba_:

• d3htba_ first appeared in SCOPe 2.01
  
• d3htba_ appears in SCOPe 2.06