SCOPe 2.05: Domain d3hswa_: 3hsw A:

Lineage for d3hswa_ (3hsw A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (25 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [186957] (9 PDB entries)

8. Domain d3hswa_: 3hsw A: [177821]
   automated match to d1hn4a_
   complexed with ca, mcw

Details for d3hswa_

PDB Entry: 3hsw, 2.5 Å

PDB Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with 2-methoxycyclohexa-2-5-diene-1,4-dione

PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d3hswa_:

Sequence; same for both SEQRES and ATOM records:

>d3hswa_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

Timeline for d3hswa_:

• d3hswa_ first appeared in SCOPe 2.01
  
• d3hswa_ appears in SCOPe 2.04
  
• d3hswa_ appears in SCOPe 2.06
  
• d3hswa_ appears in the current release, SCOPe 2.08