Lineage for d3hswa_ (3hsw A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925596Protein automated matches [190139] (19 species)
    not a true protein
  7. 925680Species Pig (Sus scrofa) [TaxId:9823] [186957] (8 PDB entries)
  8. 925685Domain d3hswa_: 3hsw A: [177821]
    automated match to d1hn4a_
    complexed with ca, mcw

Details for d3hswa_

PDB Entry: 3hsw (more details), 2.5 Å

PDB Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with 2-methoxycyclohexa-2-5-diene-1,4-dione
PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d3hswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hswa_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

SCOPe Domain Coordinates for d3hswa_:

Click to download the PDB-style file with coordinates for d3hswa_.
(The format of our PDB-style files is described here.)

Timeline for d3hswa_: