Lineage for d1cx8a1 (1cx8 A:609-760)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538960Fold a.48: N-cbl like [47667] (3 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 538970Superfamily a.48.2: Transferrin receptor ectodomain, C-terminal domain [47672] (1 family) (S)
  5. 538971Family a.48.2.1: Transferrin receptor ectodomain, C-terminal domain [47673] (1 protein)
  6. 538972Protein Transferrin receptor ectodomain, C-terminal domain [47674] (1 species)
  7. 538973Species Human (Homo sapiens) [TaxId:9606] [47675] (2 PDB entries)
  8. 538977Domain d1cx8a1: 1cx8 A:609-760 [17782]
    Other proteins in same PDB: d1cx8a2, d1cx8a3, d1cx8b2, d1cx8b3, d1cx8c2, d1cx8c3, d1cx8d2, d1cx8d3, d1cx8e2, d1cx8e3, d1cx8f2, d1cx8f3, d1cx8g2, d1cx8g3, d1cx8h2, d1cx8h3

Details for d1cx8a1

PDB Entry: 1cx8 (more details), 3.2 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor

SCOP Domain Sequences for d1cx8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx8a1 a.48.2.1 (A:609-760) Transferrin receptor ectodomain, C-terminal domain {Human (Homo sapiens)}
ldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgnaektdr
fvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnngafne
tlfrnqlalatwtiqgaanalsgdvwdidnef

SCOP Domain Coordinates for d1cx8a1:

Click to download the PDB-style file with coordinates for d1cx8a1.
(The format of our PDB-style files is described here.)

Timeline for d1cx8a1: