Lineage for d3hsva_ (3hsv A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382978Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382979Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2382980Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2382981Protein Speckle-type poz protein SPOP [141107] (2 species)
  7. 2383011Species Pongo abelii [TaxId:9601] [189088] (1 PDB entry)
  8. 2383012Domain d3hsva_: 3hsv A: [177819]
    automated match to d2cr2a1
    protein/DNA complex; complexed with so4, zn

Details for d3hsva_

PDB Entry: 3hsv (more details), 1.43 Å

PDB Description: structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: spopmathx- macroh2asbcpep2
PDB Compounds: (A:) Speckle-type POZ protein

SCOPe Domain Sequences for d3hsva_:

Sequence, based on SEQRES records: (download)

>d3hsva_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Pongo abelii [TaxId: 9601]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldean
gllpddkltlfcevsvvq

Sequence, based on observed residues (ATOM records): (download)

>d3hsva_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Pongo abelii [TaxId: 9601]}
kvvkfsymwtinnfsfcreemgeviksstfsslkwclrvnpkgldeeskdylslylllvs
cpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldeangllpd
dkltlfcevsvvq

SCOPe Domain Coordinates for d3hsva_:

Click to download the PDB-style file with coordinates for d3hsva_.
(The format of our PDB-style files is described here.)

Timeline for d3hsva_: