SCOPe 2.01: Domain d3hsva_: 3hsv A:

Lineage for d3hsva_ (3hsv A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (2 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (4 proteins)

6. Protein Speckle-type poz protein SPOP [141107] (2 species)

7. Species Pongo abelii [TaxId:9601] [189088] (1 PDB entry)

8. Domain d3hsva_: 3hsv A: [177819]
   automated match to d2cr2a1
   protein/DNA complex; complexed with so4, zn

Details for d3hsva_

PDB Entry: 3hsv, 1.43 Å

PDB Description: structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: spopmathx- macroh2asbcpep2

PDB Compounds: (A:) Speckle-type POZ protein

SCOPe Domain Sequences for d3hsva_:

Sequence, based on SEQRES records:

>d3hsva_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Pongo abelii [TaxId: 9601]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldean
gllpddkltlfcevsvvq

Sequence, based on observed residues (ATOM records):

>d3hsva_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Pongo abelii [TaxId: 9601]}
kvvkfsymwtinnfsfcreemgeviksstfsslkwclrvnpkgldeeskdylslylllvs
cpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldeangllpd
dkltlfcevsvvq

Timeline for d3hsva_:

• d3hsva_ is new in SCOPe 2.01-stable
  
• d3hsva_ appears in SCOPe 2.02
  
• d3hsva_ appears in the current release, SCOPe 2.08