Lineage for d3hsoa_ (3hso A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683350Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1683351Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1683352Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1683353Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1683635Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (169 PDB entries)
    Uniprot P29476 298-716
  8. 1683738Domain d3hsoa_: 3hso A: [177812]
    automated match to d1om4b_
    complexed with act, h4b, har, hem, no, zn

Details for d3hsoa_

PDB Entry: 3hso (more details), 2.02 Å

PDB Description: ternary structure of neuronal nitric oxide synthase with nha and no bound(1)
PDB Compounds: (A:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d3hsoa_:

Sequence, based on SEQRES records: (download)

>d3hsoa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg

Sequence, based on observed residues (ATOM records): (download)

>d3hsoa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpvrtkdqlfplakefldqyys
sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynil
eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg

SCOPe Domain Coordinates for d3hsoa_:

Click to download the PDB-style file with coordinates for d3hsoa_.
(The format of our PDB-style files is described here.)

Timeline for d3hsoa_: