SCOPe 2.08: Domain d3hsdb_: 3hsd B:

Lineage for d3hsdb_ (3hsd B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures
   automatically mapped to Pfam PF01288

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)

7. Species Escherichia coli [TaxId:562] [55086] (49 PDB entries)
   Uniprot P26281

8. Domain d3hsdb_: 3hsd B: [177807]
   automated match to d1dy3a_
   complexed with cl, gol, mg

Details for d3hsdb_

PDB Entry: 3hsd, 1.65 Å

PDB Description: crystal structure of e. coli hppk(y53a)

PDB Compounds: (B:) hppk

SCOPe Domain Sequences for d3hsdb_:

Sequence; same for both SEQRES and ATOM records:

>d3hsdb_ d.58.30.1 (B:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdalnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d3hsdb_:

• d3hsdb_ first appeared in SCOPe 2.01
  
• d3hsdb_ appears in SCOPe 2.07