Lineage for d3hsad_ (3hsa D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071561Family b.55.1.13: BPHL domain [159216] (3 proteins)
    Pfam PF08000; DUF1696, bacterial proteins with PH-like domain
  6. 2071577Protein automated matches [191060] (1 species)
    not a true protein
  7. 2071578Species Shewanella amazonensis [TaxId:326297] [188946] (1 PDB entry)
  8. 2071582Domain d3hsad_: 3hsa D: [177803]
    automated match to d3dcxa1
    complexed with gol, peg

Details for d3hsad_

PDB Entry: 3hsa (more details), 1.99 Å

PDB Description: crystal structure of pleckstrin homology domain (yp_926556.1) from shewanella amazonensis sb2b at 1.99 a resolution
PDB Compounds: (D:) pleckstrin homology domain

SCOPe Domain Sequences for d3hsad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hsad_ b.55.1.13 (D:) automated matches {Shewanella amazonensis [TaxId: 326297]}
evdlgklaaelspilgdneelqlaykmvrdlfvftskrlilidkqgvtgkkvsyhsipyk
aivhfqvetagtfdmdaelklwisgqheplvkelkrgtdvvgiqktiaryalg

SCOPe Domain Coordinates for d3hsad_:

Click to download the PDB-style file with coordinates for d3hsad_.
(The format of our PDB-style files is described here.)

Timeline for d3hsad_: