Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.13: BPHL domain [159216] (3 proteins) Pfam PF08000; DUF1696, bacterial proteins with PH-like domain |
Protein automated matches [191060] (1 species) not a true protein |
Species Shewanella amazonensis [TaxId:326297] [188946] (1 PDB entry) |
Domain d3hsaa_: 3hsa A: [177800] automated match to d3dcxa1 complexed with gol, peg |
PDB Entry: 3hsa (more details), 1.99 Å
SCOPe Domain Sequences for d3hsaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hsaa_ b.55.1.13 (A:) automated matches {Shewanella amazonensis [TaxId: 326297]} mgfldalmgnasevdlgklaaelspilgdneelqlaykmvrdlfvftskrlilidkqgvt gkkvsyhsipykaivhfqvetagtfdmdaelklwisgqheplvkelkrgtdvvgiqktia ryalg
Timeline for d3hsaa_:
View in 3D Domains from other chains: (mouse over for more information) d3hsab_, d3hsac_, d3hsad_, d3hsae_ |