Lineage for d3hrwd_ (3hrw D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688741Species Mouse (Mus musculus) [TaxId:10090] [187190] (2 PDB entries)
  8. 2688746Domain d3hrwd_: 3hrw D: [177798]
    automated match to d1jebd_
    complexed with hem

Details for d3hrwd_

PDB Entry: 3hrw (more details), 2.8 Å

PDB Description: crystal structure of hemoglobin from mouse (mus musculus)at 2.8
PDB Compounds: (D:) Hemoglobin subunit beta-1

SCOPe Domain Sequences for d3hrwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hrwd_ a.1.1.2 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vhltdaekaavsclwgkvnsdevggealgrllvvypwtqryfdsfgdlssasaimgnakv
kahgkkvitafndglnhldslkgtfaslselhcdklhvdpenfrllgnmivivlghhlgk
dftpaaqaafqkvvagvatalahkyh

SCOPe Domain Coordinates for d3hrwd_:

Click to download the PDB-style file with coordinates for d3hrwd_.
(The format of our PDB-style files is described here.)

Timeline for d3hrwd_: