SCOPe 2.08: Domain d3hqmb_: 3hqm B:

Lineage for d3hqmb_ (3hqm B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein Speckle-type poz protein SPOP [141107] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries)
   Uniprot O43791 28-173

8. Domain d3hqmb_: 3hqm B: [177783]
   automated match to d2cr2a1
   protein/DNA complex; complexed with so4

Details for d3hqmb_

PDB Entry: 3hqm, 1.74 Å

PDB Description: structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: spopmathx-cisbc2

PDB Compounds: (B:) Speckle-type POZ protein

SCOPe Domain Sequences for d3hqmb_:

Sequence, based on SEQRES records:

>d3hqmb_ b.8.1.1 (B:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
vvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylslyl
llvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldeang
llpddkltlfcevsvv

Sequence, based on observed residues (ATOM records):

>d3hqmb_ b.8.1.1 (B:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
vvkfsymwtinnfsfcreemgeviksstfssklkwclrvnpkgldeeskdylslylllvs
cpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldeangllpd
dkltlfcevsvv

Timeline for d3hqmb_:

• d3hqmb_ first appeared in SCOPe 2.01
  
• d3hqmb_ appears in SCOPe 2.07