SCOP 1.57: Domain d1fbva2: 1fbv A:47-177

Lineage for d1fbva2 (1fbv A:47-177)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.48: N-cbl like [47667] (3 superfamilies)

4. Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (1 family)

5. Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)

6. Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47671] (3 PDB entries)

8. Domain d1fbva2: 1fbv A:47-177 [17778]
   Other proteins in same PDB: d1fbva1, d1fbva3, d1fbva4, d1fbvc_

Details for d1fbva2

PDB Entry: 1fbv, 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases

SCOP Domain Sequences for d1fbva2:

Sequence; same for both SEQRES and ATOM records:

>d1fbva2 a.48.1.1 (A:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens)}
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgd

Timeline for d1fbva2:

• d1fbva2 first appeared (with stable ids) in SCOP 1.55
  
• d1fbva2 appears in SCOP 1.59
  
• d1fbva2 appears in the current release, SCOPe 2.08