Lineage for d3hqha_ (3hqh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773294Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2773295Protein Speckle-type poz protein SPOP [141107] (1 species)
  7. 2773296Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries)
    Uniprot O43791 28-173
  8. 2773321Domain d3hqha_: 3hqh A: [177779]
    automated match to d2cr2a1
    complexed with zn

Details for d3hqha_

PDB Entry: 3hqh (more details), 2.3 Å

PDB Description: structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: spopmathx- macroh2asbcpep1
PDB Compounds: (A:) Speckle-type POZ protein

SCOPe Domain Sequences for d3hqha_:

Sequence, based on SEQRES records: (download)

>d3hqha_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldean
gllpddkltlfcevsvvq

Sequence, based on observed residues (ATOM records): (download)

>d3hqha_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgdklkwclrvnpkgldeeskdylslyll
lvscpevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldeangllp
ddkltlfcevsvvq

SCOPe Domain Coordinates for d3hqha_:

Click to download the PDB-style file with coordinates for d3hqha_.
(The format of our PDB-style files is described here.)

Timeline for d3hqha_: