Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.9: Motor proteins [52641] (5 proteins) |
Protein automated matches [190129] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187145] (33 PDB entries) |
Domain d3hqdb_: 3hqd B: [177778] automated match to d1q0bb_ complexed with anp, mg, po4 |
PDB Entry: 3hqd (more details), 2.19 Å
SCOPe Domain Sequences for d3hqdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hqdb_ c.37.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv kigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyreskl trilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevn
Timeline for d3hqdb_: