| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) ![]() |
| Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
| Protein C5a anaphylotoxin [47688] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries) |
| Domain d3hqab_: 3hqa B: [177775] automated match to d1kjsa_ |
PDB Entry: 3hqa (more details), 2.59 Å
SCOPe Domain Sequences for d3hqab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hqab_ a.50.1.1 (B:) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
qkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasqlr
anis
Timeline for d3hqab_: