Lineage for d3hqab_ (3hqa B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737052Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1737053Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 1737054Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 1737058Protein C5a anaphylotoxin [47688] (2 species)
  7. 1737059Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)
  8. 1737061Domain d3hqab_: 3hqa B: [177775]
    automated match to d1kjsa_

Details for d3hqab_

PDB Entry: 3hqa (more details), 2.59 Å

PDB Description: crystal structure of human desarg-c5a
PDB Compounds: (B:) Complement C5

SCOPe Domain Sequences for d3hqab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqab_ a.50.1.1 (B:) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
qkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasqlr
anis

SCOPe Domain Coordinates for d3hqab_:

Click to download the PDB-style file with coordinates for d3hqab_.
(The format of our PDB-style files is described here.)

Timeline for d3hqab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hqaa_