![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) ![]() |
![]() | Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
![]() | Protein C5a anaphylotoxin [47688] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries) |
![]() | Domain d3hqaa_: 3hqa A: [177774] automated match to d1kjsa_ |
PDB Entry: 3hqa (more details), 2.59 Å
SCOPe Domain Sequences for d3hqaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hqaa_ a.50.1.1 (A:) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]} mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq lranis
Timeline for d3hqaa_: