Lineage for d3hqaa_ (3hqa A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1492919Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1492920Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 1492921Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 1492925Protein C5a anaphylotoxin [47688] (2 species)
  7. 1492926Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)
  8. 1492927Domain d3hqaa_: 3hqa A: [177774]
    automated match to d1kjsa_

Details for d3hqaa_

PDB Entry: 3hqa (more details), 2.59 Å

PDB Description: crystal structure of human desarg-c5a
PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d3hqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqaa_ a.50.1.1 (A:) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lranis

SCOPe Domain Coordinates for d3hqaa_:

Click to download the PDB-style file with coordinates for d3hqaa_.
(The format of our PDB-style files is described here.)

Timeline for d3hqaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hqab_