SCOPe 2.08: Domain d3hqaa_: 3hqa A:

Lineage for d3hqaa_ (3hqa A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family)

5. Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
   can be classified as disulfide-rich
   Pfam PF01821

6. Protein C5a anaphylotoxin [47688] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)

8. Domain d3hqaa_: 3hqa A: [177774]
   automated match to d1kjsa_

Details for d3hqaa_

PDB Entry: 3hqa, 2.59 Å

PDB Description: crystal structure of human desarg-c5a

PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d3hqaa_:

Sequence; same for both SEQRES and ATOM records:

>d3hqaa_ a.50.1.1 (A:) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lranis

Timeline for d3hqaa_:

• d3hqaa_ first appeared in SCOPe 2.01
  
• d3hqaa_ appears in SCOPe 2.07