Lineage for d3hq5b_ (3hq5 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923809Protein Progesterone receptor [48517] (1 species)
  7. 923810Species Human (Homo sapiens) [TaxId:9606] [48518] (10 PDB entries)
    Uniprot P06401 679-932
  8. 923823Domain d3hq5b_: 3hq5 B: [177773]
    automated match to d1a28a_
    complexed with gkk, gol, so4

Details for d3hq5b_

PDB Entry: 3hq5 (more details), 2.1 Å

PDB Description: progesterone receptor bound to an alkylpyrrolidine ligand.
PDB Compounds: (B:) progesterone receptor

SCOPe Domain Sequences for d3hq5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hq5b_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]}
qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
agmvkpllfhk

SCOPe Domain Coordinates for d3hq5b_:

Click to download the PDB-style file with coordinates for d3hq5b_.
(The format of our PDB-style files is described here.)

Timeline for d3hq5b_: