Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (8 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [188945] (1 PDB entry) |
Domain d3hq2b_: 3hq2 B: [177771] automated match to d1k9xa_ complexed with cl, f, po4, zn |
PDB Entry: 3hq2 (more details), 2.9 Å
SCOPe Domain Sequences for d3hq2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hq2b_ d.92.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} htyekeffdllkrishyseavalmhwdsrtgapkngsedraesigqlstdifniqtsdrm kelidvlyerfddlsedtkkavelakkeyeenkkipeaeykeyvilcskaetaweeakgk sdfslfspyleqliefnkrfitywgyqehpydalldlfepgvtvkvldqlfaelkeaiip lvkqvtasgnkpdtsfitkafpkekqkelslyflqelgydfdggrldetvhpfattlnrg dvrvttrydekdfrtaifgtihecghaiyeqnidealsgtnlsdgasmgihesqslfyen figrnkhfwtpyykkiqeaspvqfkdislddfvraineskpsfirveadeltyplhiiir yeiekaifsnevsvedlpslwnqkyqdylgitpqtdaegilqdvhwaggdfgyfpsyalg ymyaaqlkqkmledlpefdallergefhpikqwltekvhihgkrkkpldiikdatgeeln vrylidylsnkysnlyl
Timeline for d3hq2b_: