![]() | Class a: All alpha proteins [46456] (151 folds) |
![]() | Fold a.48: N-cbl like [47667] (3 superfamilies) |
![]() | Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (1 family) ![]() |
![]() | Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein) |
![]() | Protein N-terminal domain of cbl (N-cbl) [47670] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47671] (3 PDB entries) |
![]() | Domain d1b47c2: 1b47 C:47-177 [17777] Other proteins in same PDB: d1b47a1, d1b47a3, d1b47b1, d1b47b3, d1b47c1, d1b47c3 |
PDB Entry: 1b47 (more details), 2.2 Å
SCOP Domain Sequences for d1b47c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b47c2 a.48.1.1 (C:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens)} ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk gifpsglfqgd
Timeline for d1b47c2: