Lineage for d3hpna_ (3hpn A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1777966Species Human (Homo sapiens) [TaxId:9606] [188939] (14 PDB entries)
  8. 1778001Domain d3hpna_: 3hpn A: [177762]
    automated match to d1kgya_

Details for d3hpna_

PDB Entry: 3hpn (more details), 2.52 Å

PDB Description: ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex
PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3hpna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hpna_ b.18.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwvy
rgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtiap
deitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc

SCOPe Domain Coordinates for d3hpna_:

Click to download the PDB-style file with coordinates for d3hpna_.
(The format of our PDB-style files is described here.)

Timeline for d3hpna_: