Lineage for d1b47b2 (1b47 B:47-177)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4005Fold a.48: N-cbl like [47667] (3 superfamilies)
  4. 4006Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (1 family) (S)
  5. 4007Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 4008Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 4009Species Human (Homo sapiens) [TaxId:9606] [47671] (3 PDB entries)
  8. 4012Domain d1b47b2: 1b47 B:47-177 [17776]
    Other proteins in same PDB: d1b47a1, d1b47a3, d1b47b1, d1b47b3, d1b47c1, d1b47c3

Details for d1b47b2

PDB Entry: 1b47 (more details), 2.2 Å

PDB Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70

SCOP Domain Sequences for d1b47b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b47b2 a.48.1.1 (B:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens)}
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgd

SCOP Domain Coordinates for d1b47b2:

Click to download the PDB-style file with coordinates for d1b47b2.
(The format of our PDB-style files is described here.)

Timeline for d1b47b2: