| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.4: HIV integrase-binding domain [140576] (1 family) ![]() |
| Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins) N-terminal part of PfamB PB012949 |
| Protein automated matches [191076] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188992] (4 PDB entries) |
| Domain d3hphh1: 3hph H:348-435 [177757] Other proteins in same PDB: d3hphe2, d3hphh2 automated match to d1z9ea1 protein/DNA complex; complexed with gol, po4, zn |
PDB Entry: 3hph (more details), 2.64 Å
SCOPe Domain Sequences for d3hphh1:
Sequence, based on SEQRES records: (download)
>d3hphh1 a.48.4.1 (H:348-435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfk
vsqvimekstmlynkfknmflvgegdsv
>d3hphh1 a.48.4.1 (H:348-435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfk
vsqvimekstmlynkfknmflvgesv
Timeline for d3hphh1:
View in 3DDomains from other chains: (mouse over for more information) d3hphe1, d3hphe2, d3hphf_, d3hphg_ |