Lineage for d3hphh1 (3hph H:348-435)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714566Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2714663Superfamily a.48.4: HIV integrase-binding domain [140576] (2 families) (S)
  5. 2714664Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins)
    N-terminal part of PfamB PB012949
  6. 2714670Protein automated matches [191076] (1 species)
    not a true protein
  7. 2714671Species Human (Homo sapiens) [TaxId:9606] [188992] (6 PDB entries)
  8. 2714686Domain d3hphh1: 3hph H:348-435 [177757]
    Other proteins in same PDB: d3hphe2, d3hphh2
    automated match to d1z9ea1
    protein/DNA complex; complexed with gol, po4, zn

Details for d3hphh1

PDB Entry: 3hph (more details), 2.64 Å

PDB Description: Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD
PDB Compounds: (H:) PC4 and SFRS1-interacting protein

SCOPe Domain Sequences for d3hphh1:

Sequence, based on SEQRES records: (download)

>d3hphh1 a.48.4.1 (H:348-435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfk
vsqvimekstmlynkfknmflvgegdsv

Sequence, based on observed residues (ATOM records): (download)

>d3hphh1 a.48.4.1 (H:348-435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfk
vsqvimekstmlynkfknmflvgesv

SCOPe Domain Coordinates for d3hphh1:

Click to download the PDB-style file with coordinates for d3hphh1.
(The format of our PDB-style files is described here.)

Timeline for d3hphh1: