Lineage for d3hphg_ (3hph G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1736945Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 1737024Superfamily a.48.4: HIV integrase-binding domain [140576] (1 family) (S)
  5. 1737025Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins)
    N-terminal part of PfamB PB012949
  6. 1737031Protein automated matches [191076] (1 species)
    not a true protein
  7. 1737032Species Human (Homo sapiens) [TaxId:9606] [188992] (3 PDB entries)
  8. 1737035Domain d3hphg_: 3hph G: [177756]
    automated match to d1z9ea1
    protein/DNA complex; complexed with gol, po4, zn

Details for d3hphg_

PDB Entry: 3hph (more details), 2.64 Å

PDB Description: Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD
PDB Compounds: (G:) PC4 and SFRS1-interacting protein

SCOPe Domain Sequences for d3hphg_:

Sequence, based on SEQRES records: (download)

>d3hphg_ a.48.4.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfkvsqvi
mekstmly

Sequence, based on observed residues (ATOM records): (download)

>d3hphg_ a.48.4.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrihaeiknslkidnldvnrciealdelamittlkkirrfkvsqvimekstmly

SCOPe Domain Coordinates for d3hphg_:

Click to download the PDB-style file with coordinates for d3hphg_.
(The format of our PDB-style files is described here.)

Timeline for d3hphg_: