Class a: All alpha proteins [46456] (286 folds) |
Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.4: HIV integrase-binding domain [140576] (1 family) |
Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins) N-terminal part of PfamB PB012949 |
Protein automated matches [191076] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188992] (3 PDB entries) |
Domain d3hphg_: 3hph G: [177756] automated match to d1z9ea1 protein/DNA complex; complexed with gol, po4, zn |
PDB Entry: 3hph (more details), 2.64 Å
SCOPe Domain Sequences for d3hphg_:
Sequence, based on SEQRES records: (download)
>d3hphg_ a.48.4.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfkvsqvi mekstmly
>d3hphg_ a.48.4.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrihaeiknslkidnldvnrciealdelamittlkkirrfkvsqvimekstmly
Timeline for d3hphg_: