Lineage for d3hphf_ (3hph F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000364Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2000447Superfamily a.48.4: HIV integrase-binding domain [140576] (1 family) (S)
  5. 2000448Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins)
    N-terminal part of PfamB PB012949
  6. 2000454Protein automated matches [191076] (1 species)
    not a true protein
  7. 2000455Species Human (Homo sapiens) [TaxId:9606] [188992] (4 PDB entries)
  8. 2000459Domain d3hphf_: 3hph F: [177755]
    Other proteins in same PDB: d3hphe2, d3hphh2
    automated match to d1z9ea1
    protein/DNA complex; complexed with gol, po4, zn

Details for d3hphf_

PDB Entry: 3hph (more details), 2.64 Å

PDB Description: Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD
PDB Compounds: (F:) PC4 and SFRS1-interacting protein

SCOPe Domain Sequences for d3hphf_:

Sequence, based on SEQRES records: (download)

>d3hphf_ a.48.4.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfkvsqv
imekstmlynkfknm

Sequence, based on observed residues (ATOM records): (download)

>d3hphf_ a.48.4.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqrihaeiknslkidnldvnrciealdelmittlkkirrfkvsqvimekstmlynkfknm

SCOPe Domain Coordinates for d3hphf_:

Click to download the PDB-style file with coordinates for d3hphf_.
(The format of our PDB-style files is described here.)

Timeline for d3hphf_: