SCOPe 2.08: Domain d3hphf_: 3hph F:

Lineage for d3hphf_ (3hph F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.4: HIV integrase-binding domain [140576] (2 families)

5. Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins)
   N-terminal part of PfamB PB012949

6. Protein automated matches [191076] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188992] (6 PDB entries)

8. Domain d3hphf_: 3hph F: [177755]
   Other proteins in same PDB: d3hphe2, d3hphh2
   automated match to d1z9ea1
   protein/DNA complex; complexed with gol, po4, zn

Details for d3hphf_

PDB Entry: 3hph, 2.64 Å

PDB Description: Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD

PDB Compounds: (F:) PC4 and SFRS1-interacting protein

SCOPe Domain Sequences for d3hphf_:

Sequence, based on SEQRES records:

>d3hphf_ a.48.4.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfkvsqv
imekstmlynkfknm

Sequence, based on observed residues (ATOM records):

>d3hphf_ a.48.4.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqrihaeiknslkidnldvnrciealdelmittlkkirrfkvsqvimekstmlynkfknm

Timeline for d3hphf_:

• d3hphf_ first appeared in SCOPe 2.01
  
• d3hphf_ appears in SCOPe 2.07