Lineage for d3hphe1 (3hph E:348-435)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997956Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 1998036Superfamily a.48.4: HIV integrase-binding domain [140576] (1 family) (S)
  5. 1998037Family a.48.4.1: HIV integrase-binding domain [140577] (2 protein domains)
    N-terminal part of PfamB PB012949
  6. 1998043Protein automated matches [191076] (1 species)
    not a true protein
  7. 1998044Species Human (Homo sapiens) [TaxId:9606] [188992] (3 PDB entries)
  8. 1998045Domain d3hphe1: 3hph E:348-435 [177754]
    Other proteins in same PDB: d3hphe2, d3hphh2
    automated match to d1z9ea1
    protein/DNA complex; complexed with gol, po4, zn

Details for d3hphe1

PDB Entry: 3hph (more details), 2.64 Å

PDB Description: Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD
PDB Compounds: (E:) PC4 and SFRS1-interacting protein

SCOPe Domain Sequences for d3hphe1:

Sequence, based on SEQRES records: (download)

>d3hphe1 a.48.4.1 (E:348-435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfk
vsqvimekstmlynkfknmflvgegdsv

Sequence, based on observed residues (ATOM records): (download)

>d3hphe1 a.48.4.1 (E:348-435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfk
vsqvimekstmlynkfknmflvsv

SCOPe Domain Coordinates for d3hphe1:

Click to download the PDB-style file with coordinates for d3hphe1.
(The format of our PDB-style files is described here.)

Timeline for d3hphe1: