SCOPe 2.06: Domain d3hpea_: 3hpe A:

Lineage for d3hpea_ (3hpe A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.6: YceI-like [101874] (2 families)

5. Family b.61.6.0: automated matches [191627] (1 protein)
   not a true family

6. Protein automated matches [191150] (2 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [189304] (1 PDB entry)

8. Domain d3hpea_: 3hpe A: [177752]
   automated match to d1wuba_
   complexed with eru

Details for d3hpea_

PDB Entry: 3hpe, 2.1 Å

PDB Description: crystal structure of ycei (hp1286) from helicobacter pylori

PDB Compounds: (A:) Conserved hypothetical secreted protein

SCOPe Domain Sequences for d3hpea_:

Sequence; same for both SEQRES and ATOM records:

>d3hpea_ b.61.6.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
kpytidkanssvwfevkhfkfnetrgvfdsfdgkidadpntkalnvfegkidiksintrn
kkrddhlktaeffdvvkypkgsfkmtkyedgkihgdltlhgvtkpvvleakiqaplqnpm
nkkefmvlqaegkinrkdfgigktfsdavvgdevkielkleaya

Timeline for d3hpea_:

• d3hpea_ first appeared in SCOPe 2.01
  
• d3hpea_ appears in SCOPe 2.05
  
• d3hpea_ appears in SCOPe 2.07
  
• d3hpea_ appears in the current release, SCOPe 2.08