Lineage for d3hpea_ (3hpe A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2397327Superfamily b.61.6: YceI-like [101874] (2 families) (S)
  5. 2397339Family b.61.6.0: automated matches [191627] (1 protein)
    not a true family
  6. 2397340Protein automated matches [191150] (2 species)
    not a true protein
  7. 2397346Species Helicobacter pylori [TaxId:210] [189304] (1 PDB entry)
  8. 2397347Domain d3hpea_: 3hpe A: [177752]
    automated match to d1wuba_
    complexed with eru

Details for d3hpea_

PDB Entry: 3hpe (more details), 2.1 Å

PDB Description: crystal structure of ycei (hp1286) from helicobacter pylori
PDB Compounds: (A:) Conserved hypothetical secreted protein

SCOPe Domain Sequences for d3hpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hpea_ b.61.6.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
kpytidkanssvwfevkhfkfnetrgvfdsfdgkidadpntkalnvfegkidiksintrn
kkrddhlktaeffdvvkypkgsfkmtkyedgkihgdltlhgvtkpvvleakiqaplqnpm
nkkefmvlqaegkinrkdfgigktfsdavvgdevkielkleaya

SCOPe Domain Coordinates for d3hpea_:

Click to download the PDB-style file with coordinates for d3hpea_.
(The format of our PDB-style files is described here.)

Timeline for d3hpea_: