![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins) |
![]() | Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [102637] (2 PDB entries) |
![]() | Domain d3hpda_: 3hpd A: [177751] complexed with po4 |
PDB Entry: 3hpd (more details), 1.85 Å
SCOPe Domain Sequences for d3hpda_:
Sequence, based on SEQRES records: (download)
>d3hpda_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Pyrococcus horikoshii [TaxId: 53953]} mkfiiealkrvrerrplvhnitnfvvmnttanallalgaspvmahaeeeleemirladav vinigtldsgwrrsmvkateianelgkpivldpvgagatkfrtrvsleilsrgvdvlkgn fgeisallgeegktrgvdsleygeeeakkltmnaarefnttvavtgavdyvsdgrrtfav ynghellgrvtgtgcmvaaltgafvavteplkattsalvtfgiaaekayeeakypgsfhv klydwlyrinenvirtyakvreve
>d3hpda_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Pyrococcus horikoshii [TaxId: 53953]} mkfiiealkrvrerrplvhnitnfvvmnttanallalgaspvmahaeeeleemirladav vinigtldsgwrrsmvkateianelgkpivldpvgagatkfrtrvsleilsrgvdvlkgn fgeisallgeeggeeeakkltmnaarefnttvavtgavdyvsdgrrtfavynghellgrv tgtgcmvaaltgafvavteplkattsalvtfgiaaekayeeakypgsfhvklydwlyrin envirtyakvreve
Timeline for d3hpda_: