Lineage for d3hpda_ (3hpd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137573Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 protein domains)
  6. 2137582Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species)
  7. 2137597Species Pyrococcus horikoshii [TaxId:53953] [102637] (2 PDB entries)
  8. 2137599Domain d3hpda_: 3hpd A: [177751]
    complexed with po4

Details for d3hpda_

PDB Entry: 3hpd (more details), 1.85 Å

PDB Description: Structure of hydroxyethylthiazole kinase protein from pyrococcus horikoshii OT3
PDB Compounds: (A:) hydroxyethylthiazole kinase

SCOPe Domain Sequences for d3hpda_:

Sequence, based on SEQRES records: (download)

>d3hpda_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Pyrococcus horikoshii [TaxId: 53953]}
mkfiiealkrvrerrplvhnitnfvvmnttanallalgaspvmahaeeeleemirladav
vinigtldsgwrrsmvkateianelgkpivldpvgagatkfrtrvsleilsrgvdvlkgn
fgeisallgeegktrgvdsleygeeeakkltmnaarefnttvavtgavdyvsdgrrtfav
ynghellgrvtgtgcmvaaltgafvavteplkattsalvtfgiaaekayeeakypgsfhv
klydwlyrinenvirtyakvreve

Sequence, based on observed residues (ATOM records): (download)

>d3hpda_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Pyrococcus horikoshii [TaxId: 53953]}
mkfiiealkrvrerrplvhnitnfvvmnttanallalgaspvmahaeeeleemirladav
vinigtldsgwrrsmvkateianelgkpivldpvgagatkfrtrvsleilsrgvdvlkgn
fgeisallgeeggeeeakkltmnaarefnttvavtgavdyvsdgrrtfavynghellgrv
tgtgcmvaaltgafvavteplkattsalvtfgiaaekayeeakypgsfhvklydwlyrin
envirtyakvreve

SCOPe Domain Coordinates for d3hpda_:

Click to download the PDB-style file with coordinates for d3hpda_.
(The format of our PDB-style files is described here.)

Timeline for d3hpda_: