Lineage for d3hp3j_ (3hp3 J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929256Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 2929257Species Human (Homo sapiens) [TaxId:9606] [54151] (21 PDB entries)
  8. 2929279Domain d3hp3j_: 3hp3 J: [177747]
    automated match to d1sdfa_
    complexed with au

Details for d3hp3j_

PDB Entry: 3hp3 (more details), 2.2 Å

PDB Description: crystal structure of cxcl12
PDB Compounds: (J:) CXCL12 protein

SCOPe Domain Sequences for d3hp3j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hp3j_ d.9.1.1 (J:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
slsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeyle
kal

SCOPe Domain Coordinates for d3hp3j_:

Click to download the PDB-style file with coordinates for d3hp3j_.
(The format of our PDB-style files is described here.)

Timeline for d3hp3j_: