Lineage for d2cbla2 (2cbl A:47-177)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4005Fold a.48: N-cbl like [47667] (3 superfamilies)
  4. 4006Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (1 family) (S)
  5. 4007Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 4008Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 4009Species Human (Homo sapiens) [TaxId:9606] [47671] (3 PDB entries)
  8. 4010Domain d2cbla2: 2cbl A:47-177 [17774]
    Other proteins in same PDB: d2cbla1, d2cbla3

Details for d2cbla2

PDB Entry: 2cbl (more details), 2.1 Å

PDB Description: n-terminal domain of cbl in complex with its binding site on zap-70

SCOP Domain Sequences for d2cbla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbla2 a.48.1.1 (A:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens)}
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgd

SCOP Domain Coordinates for d2cbla2:

Click to download the PDB-style file with coordinates for d2cbla2.
(The format of our PDB-style files is described here.)

Timeline for d2cbla2: