Lineage for d3hoja_ (3hoj A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1566872Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 1566996Protein automated matches [190053] (8 species)
    not a true protein
  7. 1566997Species Artificial gene [TaxId:32630] [188991] (7 PDB entries)
  8. 1567002Domain d3hoja_: 3hoj A: [177734]
    automated match to d1a53a_

Details for d3hoja_

PDB Entry: 3hoj (more details), 2.2 Å

PDB Description: Crystal Structure of a Novel Engineered Retroaldolase: RA-22
PDB Compounds: (A:) retroaldolase-22

SCOPe Domain Sequences for d3hoja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hoja_ c.1.2.4 (A:) automated matches {Artificial gene [TaxId: 32630]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiagydrkspsgld
verdpieyskfmeryavglsitteekyfngsyetlrkiassvsipilmadfivkesqidd
aynlgadtvalivkiltereleslleyarsygmeplikindendldialrigarfigivs
adwetleinkenqrklismipsnvvkvaafgiserneieelrklgvnafsihsslmrnpe
kikefil

SCOPe Domain Coordinates for d3hoja_:

Click to download the PDB-style file with coordinates for d3hoja_.
(The format of our PDB-style files is described here.)

Timeline for d3hoja_: