SCOPe 2.04: Domain d3hoja_: 3hoj A:

Lineage for d3hoja_ (3hoj A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein automated matches [190053] (8 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [188991] (7 PDB entries)

8. Domain d3hoja_: 3hoj A: [177734]
   automated match to d1a53a_

Details for d3hoja_

PDB Entry: 3hoj, 2.2 Å

PDB Description: Crystal Structure of a Novel Engineered Retroaldolase: RA-22

PDB Compounds: (A:) retroaldolase-22

SCOPe Domain Sequences for d3hoja_:

Sequence; same for both SEQRES and ATOM records:

>d3hoja_ c.1.2.4 (A:) automated matches {Artificial gene [TaxId: 32630]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiagydrkspsgld
verdpieyskfmeryavglsitteekyfngsyetlrkiassvsipilmadfivkesqidd
aynlgadtvalivkiltereleslleyarsygmeplikindendldialrigarfigivs
adwetleinkenqrklismipsnvvkvaafgiserneieelrklgvnafsihsslmrnpe
kikefil

Timeline for d3hoja_:

• d3hoja_ first appeared in SCOPe 2.01
  
• d3hoja_ appears in SCOPe 2.03
  
• d3hoja_ appears in SCOPe 2.05
  
• d3hoja_ appears in the current release, SCOPe 2.08