Lineage for d1fioa_ (1fio A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323361Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2323374Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2323375Family a.47.2.1: t-snare proteins [47662] (6 protein domains)
  6. 2323376Protein Sso1 [47665] (1 species)
  7. 2323377Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47666] (1 PDB entry)
  8. 2323378Domain d1fioa_: 1fio A: [17773]
    complexed with zn

Details for d1fioa_

PDB Entry: 1fio (more details), 2.1 Å

PDB Description: crystal structure of yeast t-snare protein sso1
PDB Compounds: (A:) sso1 protein

SCOPe Domain Sequences for d1fioa_:

Sequence, based on SEQRES records: (download)

>d1fioa_ a.47.2.1 (A:) Sso1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhdfvgfmnkisqinrdldkydhtinqvdslhkrlltevneeqashlrhsldnfvaqatd
lqfklkneiksaqrdgihdtnkqaqaensrqrflkliqdyrivdsnykeenkeqakrqym
iiqpeatedeveaaisdvggqqifsqallnanrrgeaktalaevqarhqellkleksmae
ltqlfndmeelvieqq

Sequence, based on observed residues (ATOM records): (download)

>d1fioa_ a.47.2.1 (A:) Sso1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhdfvgfmnkisqinrdldkydhtinqvdslhkrlltevneeqashlrhsldnfvaqatd
lqfklkneiksaqrdgihdtnkqaqaensrqrflkliqdyrivdsnykeenkeqakrqym
iiqpeatedeveaaisdvggqqifsqalleaktalaevqarhqellkleksmaeltqlfn
dmeelvieqq

SCOPe Domain Coordinates for d1fioa_:

Click to download the PDB-style file with coordinates for d1fioa_.
(The format of our PDB-style files is described here.)

Timeline for d1fioa_: