| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
| Protein automated matches [190377] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187224] (7 PDB entries) |
| Domain d3hobm_: 3hob M: [177728] automated match to d1d7pm_ |
PDB Entry: 3hob (more details), 2.07 Å
SCOPe Domain Sequences for d3hobm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hobm_ b.18.1.2 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqv
dfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftp
vvnsldpplltrylrihpqswvhqialrmevlgcea
Timeline for d3hobm_: