SCOPe 2.05: Domain d3hoba_: 3hob A:

Lineage for d3hoba_ (3hob A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
   automatically mapped to Pfam PF00754

6. Protein automated matches [190377] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187224] (7 PDB entries)

8. Domain d3hoba_: 3hob A: [177727]
   automated match to d1d7pm_

Details for d3hoba_

PDB Entry: 3hob, 2.07 Å

PDB Description: factor viii trp2313-his2315 segment is involved in membrane binding as shown by crystal structure of complex between factor viii c2 domain and an inhibitor

PDB Compounds: (A:) coagulation factor viii

SCOPe Domain Sequences for d3hoba_:

Sequence; same for both SEQRES and ATOM records:

>d3hoba_ b.18.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqv
dfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftp
vvnsldpplltrylrihpqswvhqialrmevlgcea

Timeline for d3hoba_:

• d3hoba_ first appeared in SCOPe 2.01
  
• d3hoba_ appears in SCOPe 2.04
  
• d3hoba_ appears in SCOPe 2.06
  
• d3hoba_ appears in the current release, SCOPe 2.08