Lineage for d3hnym_ (3hny M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774124Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 2774165Protein automated matches [190377] (2 species)
    not a true protein
  7. 2774166Species Human (Homo sapiens) [TaxId:9606] [187224] (7 PDB entries)
  8. 2774168Domain d3hnym_: 3hny M: [177722]
    automated match to d1d7pm_

Details for d3hnym_

PDB Entry: 3hny (more details), 1.07 Å

PDB Description: factor viii trp2313-his2315 segment is involved in membrane binding as shown by crystal structure of complex between factor viii c2 domain and an inhibitor
PDB Compounds: (M:) coagulation factor viii

SCOPe Domain Sequences for d3hnym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hnym_ b.18.1.2 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqv
dfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftp
vvnsldpplltrylrihpqswvhqialrmevlgcea

SCOPe Domain Coordinates for d3hnym_:

Click to download the PDB-style file with coordinates for d3hnym_.
(The format of our PDB-style files is described here.)

Timeline for d3hnym_: