Lineage for d1br0a_ (1br0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714459Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2714477Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2714478Family a.47.2.1: t-snare proteins [47662] (6 proteins)
  6. 2714482Protein Syntaxin 1A N-terminal domain [47663] (2 species)
  7. 2714486Species Norway rat (Rattus norvegicus) [TaxId:10116] [47664] (3 PDB entries)
  8. 2714491Domain d1br0a_: 1br0 A: [17772]
    three-helical fragment; similar to one spectrin repeat
    missing some secondary structures that made up less than one-third of the common domain

Details for d1br0a_

PDB Entry: 1br0 (more details)

PDB Description: three dimensional structure of the n-terminal domain of syntaxin 1a
PDB Compounds: (A:) protein (syntaxin 1-a)

SCOPe Domain Sequences for d1br0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br0a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
drfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkta
nkvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrersk

SCOPe Domain Coordinates for d1br0a_:

Click to download the PDB-style file with coordinates for d1br0a_.
(The format of our PDB-style files is described here.)

Timeline for d1br0a_: