SCOPe 2.01: Domain d3hnka_: 3hnk A:

Lineage for d3hnka_ (3hnk A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (2 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)

6. Protein automated matches [190502] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)

8. Domain d3hnka_: 3hnk A: [177718]
   automated match to d1qq3a_
   complexed with hem

Details for d3hnka_

PDB Entry: 3hnk, 2.1 Å

PDB Description: crystal structure of the dimeric assembly of the cyt cb562 variant ridc-1

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d3hnka_:

Sequence; same for both SEQRES and ATOM records:

>d3hnka_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr

Timeline for d3hnka_:

• d3hnka_ is new in SCOPe 2.01-stable
  
• d3hnka_ appears in SCOPe 2.02
  
• d3hnka_ appears in the current release, SCOPe 2.08