Class a: All alpha proteins [46456] (286 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.4: PqqC-like [101463] (2 proteins) Pfam PF05312 |
Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species) |
Species Klebsiella pneumoniae [TaxId:272620] [189325] (4 PDB entries) |
Domain d3hnha_: 3hnh A: [177705] automated match to d1otva_ complexed with ahq; mutant |
PDB Entry: 3hnh (more details), 1.8 Å
SCOPe Domain Sequences for d3hnha_:
Sequence, based on SEQRES records: (download)
>d3hnha_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]} litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfsfrssls qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd kaawhttrlvle
>d3hnha_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]} litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd aaimancpdaqtrrkwvqrildhdgsdggieawlrlgeavglsrddllserhvlpgvrfa vdaylnfarracwqeaacssltelfapqhypwikeegyfsfrsslsqanrdvehglalak aycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtdkaawhttrlvle
Timeline for d3hnha_: