Lineage for d3hnbm_ (3hnb M:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383809Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 2383850Protein automated matches [190377] (2 species)
    not a true protein
  7. 2383851Species Human (Homo sapiens) [TaxId:9606] [187224] (7 PDB entries)
  8. 2383852Domain d3hnbm_: 3hnb M: [177704]
    automated match to d1d7pm_
    complexed with 768

Details for d3hnbm_

PDB Entry: 3hnb (more details), 1.15 Å

PDB Description: Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal structure of complex between factor VIII C2 domain and an inhibitor
PDB Compounds: (M:) coagulation factor viii

SCOPe Domain Sequences for d3hnbm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hnbm_ b.18.1.2 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqv
dfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftp
vvnsldpplltrylrihpqswvhqialrmevlgcea

SCOPe Domain Coordinates for d3hnbm_:

Click to download the PDB-style file with coordinates for d3hnbm_.
(The format of our PDB-style files is described here.)

Timeline for d3hnbm_: