| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.2: t-snare proteins [47661] (1 family) ![]() |
| Family a.47.2.1: t-snare proteins [47662] (6 proteins) |
| Protein Syntaxin 1A N-terminal domain [47663] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [47664] (3 PDB entries) |
| Domain d1ez3c_: 1ez3 C: [17770] three-helical fragment; similar to one spectrin repeat missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1ez3 (more details), 1.9 Å
SCOPe Domain Sequences for d1ez3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ez3c_ a.47.2.1 (C:) Syntaxin 1A N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkt
ankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerc
kgri
Timeline for d1ez3c_: