SCOPe 2.08: Domain d1ez3c_: 1ez3 C:

Lineage for d1ez3c_ (1ez3 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.2: t-snare proteins [47661] (1 family)

5. Family a.47.2.1: t-snare proteins [47662] (6 proteins)

6. Protein Syntaxin 1A N-terminal domain [47663] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47664] (3 PDB entries)

8. Domain d1ez3c_: 1ez3 C: [17770]
   three-helical fragment; similar to one spectrin repeat
   missing some secondary structures that made up less than one-third of the common domain

Details for d1ez3c_

PDB Entry: 1ez3, 1.9 Å

PDB Description: crystal structure of the neuronal t-snare syntaxin-1a

PDB Compounds: (C:) syntaxin-1a

SCOPe Domain Sequences for d1ez3c_:

Sequence; same for both SEQRES and ATOM records:

>d1ez3c_ a.47.2.1 (C:) Syntaxin 1A N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkt
ankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerc
kgri

Timeline for d1ez3c_:

• d1ez3c_ first appeared (with stable ids) in SCOP 1.55
  
• d1ez3c_ appears in SCOPe 2.07