Lineage for d3hmqa_ (3hmq A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2119958Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2120085Protein automated matches [190257] (4 species)
    not a true protein
  7. 2120093Species Salmonella typhimurium [TaxId:90371] [188917] (1 PDB entry)
  8. 2120094Domain d3hmqa_: 3hmq A: [177699]
    automated match to d1wxea1
    complexed with nad, so4

Details for d3hmqa_

PDB Entry: 3hmq (more details), 1.9 Å

PDB Description: 1.9 angstrom resolution crystal structure of a nad synthetase (nade) from salmonella typhimurium lt2 in complex with nad(+)
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3hmqa_:

Sequence, based on SEQRES records: (download)

>d3hmqa_ c.26.2.1 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mtlqqeiiqalgakphinpeeeirrsvdflkaylktypflkslvlgisggqdstlagkls
qmaiaelreetgdnalqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseq
alreagielsdfvrgnekarermkaqysiagmthgvvvgtdhaaeaitgfftkygdggtd
inplhrlnkrqgkqllaalgcpehlykkvptadleddrpslpdeaalgvtydniddyleg
ktldpaiaktiegwyvktehkrrlpitvfddfwkr

Sequence, based on observed residues (ATOM records): (download)

>d3hmqa_ c.26.2.1 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mtlqqeiiqalgakphinpeeeirrsvdflkaylktypflkslvlgisggqdstlagkls
qmaiaelreetgdnalqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseq
alreagielsdfvrgnekarermkaqysiagmthgvvvgtdhaaeaitgfftkygdggtd
inplhrlnkrqgkqllaalgcpehlykkpdeaalgvtydniddylegktldpaiaktieg
wyvktehkrrlpitvfddfwkr

SCOPe Domain Coordinates for d3hmqa_:

Click to download the PDB-style file with coordinates for d3hmqa_.
(The format of our PDB-style files is described here.)

Timeline for d3hmqa_: