Lineage for d3hmlb1 (3hml B:3-251)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011636Family a.132.1.4: PqqC-like [101463] (2 protein domains)
    Pfam PF05312
  6. 2011637Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 2011638Species Klebsiella pneumoniae [TaxId:272620] [189325] (4 PDB entries)
  8. 2011645Domain d3hmlb1: 3hml B:3-251 [177697]
    Other proteins in same PDB: d3hmla2, d3hmlb2
    automated match to d1otva_
    complexed with pqq; mutant

Details for d3hmlb1

PDB Entry: 3hml (more details), 2.35 Å

PDB Description: crystal structure of pqqc active site mutant h154s in complex with pqq
PDB Compounds: (B:) Pyrroloquinoline-quinone synthase

SCOPe Domain Sequences for d3hmlb1:

Sequence, based on SEQRES records: (download)

>d3hmlb1 a.132.1.4 (B:3-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]}
itdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkda
aimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgvr
favdaylnfarracwqeaacssltelfapqisqsrldswpqhypwikeegyfyfrsrlsq
anrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtdk
aawhttrlv

Sequence, based on observed residues (ATOM records): (download)

>d3hmlb1 a.132.1.4 (B:3-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]}
itdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkda
aimancpdaqtrrkwvqrildhdgsdggieawlrlgeavglsrddllserhvlpgvrfav
daylnfarracwqeaacssltelfapswpqhypwikeegyfyfrsrlsdvehglalakay
cdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtdkaawhttrlv

SCOPe Domain Coordinates for d3hmlb1:

Click to download the PDB-style file with coordinates for d3hmlb1.
(The format of our PDB-style files is described here.)

Timeline for d3hmlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hmlb2