Class a: All alpha proteins [46456] (284 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.4: PqqC-like [101463] (2 proteins) Pfam PF05312 |
Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species) |
Species Klebsiella pneumoniae [TaxId:272620] [189325] (3 PDB entries) |
Domain d3hmla_: 3hml A: [177696] automated match to d1otva_ complexed with pqq; mutant |
PDB Entry: 3hml (more details), 2.35 Å
SCOPe Domain Sequences for d3hmla_:
Sequence, based on SEQRES records: (download)
>d3hmla_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]} litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv rfavdaylnfarracwqeaacssltelfapqisqsrldswpqhypwikeegyfyfrsrls qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd kaawhttrlvle
>d3hmla_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]} litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd aaimancpdaqtrrkwvqrildhdgsdggieawlrlgeavglsrddllserhvlpgvrfa vdaylnfarracwqeaacssltelfapswpqhypwikeegyfyfrsrlsdvehglalaka ycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtdkaawhttrlvle
Timeline for d3hmla_: