![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
![]() | Family d.118.1.0: automated matches [191348] (1 protein) not a true family |
![]() | Protein automated matches [190280] (10 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [189356] (3 PDB entries) |
![]() | Domain d3hmbc_: 3hmb C: [177694] Other proteins in same PDB: d3hmbb2 automated match to d1yb0a1 complexed with zn; mutant |
PDB Entry: 3hmb (more details), 2.7 Å
SCOPe Domain Sequences for d3hmbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hmbc_ d.118.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} mvniiqkfipvgannrpgyamkpkyitvhntantavgadaaaharylknpdtttswhftv ddkeiyqhlplnengwhagdgngsgnrasigieicenadgdfakatanaqwliktlmaeh nislanvvphkywsgkecprklldkwdsfkagig
Timeline for d3hmbc_: