Lineage for d3hmbb_ (3hmb B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924236Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1924237Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1924438Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 1924439Protein automated matches [190280] (4 species)
    not a true protein
  7. 1924443Species Bacillus subtilis [TaxId:1423] [189356] (2 PDB entries)
  8. 1924446Domain d3hmbb_: 3hmb B: [177693]
    automated match to d1yb0a1
    complexed with zn; mutant

Details for d3hmbb_

PDB Entry: 3hmb (more details), 2.7 Å

PDB Description: mutant endolysin from bacillus subtilis
PDB Compounds: (B:) N-acetylmuramoyl-L-alanine amidase xlyA

SCOPe Domain Sequences for d3hmbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmbb_ d.118.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
shmvniiqkfipvgannrpgyamkpkyitvhntantavgadaaaharylknpdtttswhf
tvddkeiyqhlplnengwhagdgngsgnrasigieicenadgdfakatanaqwliktlma
ehnislanvvphkywsgkecprklldkwdsfkagig

SCOPe Domain Coordinates for d3hmbb_:

Click to download the PDB-style file with coordinates for d3hmbb_.
(The format of our PDB-style files is described here.)

Timeline for d3hmbb_: